Home » Messageboard » Archive 40531
(Older | Newer )
Oh Hai :)
(
Hitler's Barber Soylent Green is high in saturated fat ,
Mon 21 May 2012, 21:10,
archived )
extreme circumcision
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 21:15,
archived )
D-:
Again with the cock cutting!
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 21:16,
archived )
Mmmmm, meaty
(
Ghoti Fingers ,
Mon 21 May 2012, 21:17,
archived )
ouch
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 21:19,
archived )
hai there!
(
discomeats This canoe ,
Mon 21 May 2012, 21:21,
archived )
your cocks always look like cartoon noses or 1950s space rockets
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 21:23,
archived )
A lot happened in the 1950's
(
discomeats This canoe ,
Mon 21 May 2012, 21:30,
archived )
And the 70s
(
drimble he'd been white, he'd been black ,
Mon 21 May 2012, 21:33,
archived )
It looks like
*puts on sunglasses* There'll beano end to knob gags today
(
discomeats This canoe ,
Mon 21 May 2012, 21:35,
archived )
It'll probably be midnight biffo they're finished
(
drimble he'd been white, he'd been black ,
Mon 21 May 2012, 21:37,
archived )
those kids they can't stop bashing it
(
discomeats This canoe ,
Mon 21 May 2012, 21:38,
archived )
This is epic :D
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 21:38,
archived )
I suspect he's holding onto the chick in that manner so that when he finally gives up on his puny gun he can jump out of the way
thus leaving her to her doom while he escapes.
(
discomeats This canoe ,
Mon 21 May 2012, 21:39,
archived )
At least he knows to shoot for the balls
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 21:45,
archived )
This is how I like to display all the severed cocks in my house :)
(
Hitler's Barber Soylent Green is high in saturated fat ,
Mon 21 May 2012, 21:25,
archived )
it's a fine way to display them
it's also the recommended manner for the International Guild of Sausage Fanciers for when they have displays of the Wurst the World has to offer.
(
discomeats This canoe ,
Mon 21 May 2012, 21:31,
archived )
It took Linda.
Then it came after me, it got into my cock and it went bad, so I lopped it off at the base. But that didn't stop it, it came back big time.For God's sake, how do you stop it?
(
drimble he'd been white, he'd been black ,
Mon 21 May 2012, 21:25,
archived )
I have an urge
to listen to Coldcut's 'Timber' now.
(
The Silent Channel is getting his recommended 5-a-day ,
Mon 21 May 2012, 21:34,
archived )
Jesus
That didn't half make me wince.
(
Tangy bzzzzzzzzt ,
Mon 21 May 2012, 22:20,
archived )
I've been busy making transparent screen images...
(
Wize ,
Mon 21 May 2012, 21:02,
archived )
How do we know you haven't just got a screen from a broken one?
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 21:05,
archived )
I did one using a digital photo frame
And then thought whats the point. I could have just taken the back off a normal photo frame.
(
Wize ,
Mon 21 May 2012, 21:10,
archived )
Yay, Real Photo Monday
(
Ghoti Fingers ,
Mon 21 May 2012, 21:06,
archived )
Ok, its a real photo...
...but its got a home made one on the phone.
(
Wize ,
Mon 21 May 2012, 21:08,
archived )
Yay, Real Photo-of-a-Photo Monday
But if that's real, then it's verr good
(
Ghoti Fingers ,
Mon 21 May 2012, 21:14,
archived )
WAILAAPOAPOYP?
Ach, who cares, nice pic.
(
Cassius Kray floats like a butterfly, stings like a trout ,
Mon 21 May 2012, 21:19,
archived )
swap the mug for another phone
so it looks like ...etc
(
patella ,
Mon 21 May 2012, 21:30,
archived )
b3tans working for the council ???
(
De ExE nom nom nom nom ,
Mon 21 May 2012, 20:02,
archived )
WHE LIGHT WAIT?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:03,
archived )
exactle
(
De ExE nom nom nom nom ,
Mon 21 May 2012, 20:08,
archived )
Candlezzzzzzzz
happy flames belatedly : D
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 20:21,
archived )
they still burning!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:22,
archived )
Happy candles :)
(
Jahled Three shades of black ,
Mon 21 May 2012, 20:21,
archived )
8 years of utter shite!
edit: fuck, only just seen that animate!!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:22,
archived )
She has issues
(
Jahled Three shades of black ,
Mon 21 May 2012, 20:50,
archived )
Is that Cirencester in the background?
(
Ghoti Fingers ,
Mon 21 May 2012, 22:29,
archived )
Good guess, but Dundee
Hence her excitement at trying to make her head explode
(
Jahled Three shades of black ,
Mon 21 May 2012, 23:36,
archived )
Yay!
needs sound.... "CRAKbdbdbdbdbdbbdbdbddd"
(
mamilla_sarsum um... a vial is enough, no jam-jars please ,
Tue 22 May 2012, 0:52,
archived )
Happy day of candlenessmas :)
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 20:28,
archived )
I've waited 8 years for this day
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:30,
archived )
Happy candles..
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:29,
archived )
cheers
me and Fluffy elephans are off to a titty-bar to celebrate later. Fancy coming?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:31,
archived )
I think I just have
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:33,
archived )
*checks*
no, that's just piss
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:34,
archived )
piss puss
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:38,
archived )
*boke*
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:40,
archived )
I just came at the mere mention of the word titty bar! Thanks but I'd better go and dry off ;-)
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:36,
archived )
I was first!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:38,
archived )
does this mean that I have to eat the biscuit?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:39,
archived )
Fuck yeah!
* Do the kids still play that game?
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:40,
archived )
did anyone ever?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:41,
archived )
Errr
It was either that or get beaten up by the head teacher my mate big brother!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:43,
archived )
My mates at school claimed to have......
I remember when they were talking about it, I was just stood there thinking "Why?"
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:45,
archived )
I doubt it.
'googles' Edit: EWWW
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 20:59,
archived )
Puts a new slant on a custard cream..
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:40,
archived )
pustard cream
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 21:05,
archived )
I'v been sitting in a pool of my own piss all day ;-)
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:40,
archived )
Yeah, but that's normal isn't it?
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:40,
archived )
Just because all the foam in my computer seat has dissolved.....
Yes:-)
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:42,
archived )
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:45,
archived )
I'm still waiting for the last bottle I ordered to arive....
I suspect you have just kept the money and are never going to send it...
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:47,
archived )
You ordered the wrong one you fool!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:52,
archived )
Might be suitable to style my hair with too¬!
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:57,
archived )
that's because your foam lacks piss repelling abilities
you should pop into argos and ask for a piss free office chair.
(
discomeats This canoe ,
Mon 21 May 2012, 21:36,
archived )
Happy candles and that
(
drimble he'd been white, he'd been black ,
Mon 21 May 2012, 21:39,
archived )
Caaaaaaaaaaaaandlesssssssss
(
mediocre ha ha ha, you're reading this ,
Mon 21 May 2012, 20:48,
archived )
hahah
(
Richard Shitheels ,
Mon 21 May 2012, 20:50,
archived )
What terrible asthma.
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 20:54,
archived )
Hahaha!
That's proper mental
(
Jahled Three shades of black ,
Mon 21 May 2012, 20:55,
archived )
YAY!!!!
No sausages?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 21:05,
archived )
Happy Candle day!
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 20:57,
archived )
hooray!
(
pzyko Query failed. ,
Mon 21 May 2012, 21:02,
archived )
Is the Butt Inn having a laugh?
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 20:08,
archived )
i dont know but it made me chuckle
(
De ExE nom nom nom nom ,
Mon 21 May 2012, 20:10,
archived )
cover up the 'Inn' bit and retake the photo
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:36,
archived )
A bit like this?
(
Chumps 👀 ,
Mon 21 May 2012, 20:38,
archived )
hahahaha!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 21:06,
archived )
quick
tell teh internets
(
Thor_sonofodin has done things, terrible things on ,
Mon 21 May 2012, 20:10,
archived )
I bet it's this place
(
mr horrible up yours, dickface ,
Mon 21 May 2012, 20:22,
archived )
ah, The Saracens Head.
I want a luncheon and a supper now.
(
discomeats This canoe ,
Mon 21 May 2012, 21:38,
archived )
FAQ please
(
Notorious P I G is deep undercover and reporting back on ,
Mon 21 May 2012, 20:11,
archived )
now, that is niche office equipment
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:16,
archived )
assuming it's a photo they took, what FAQ rule have they broken?
(
HappyToast Groat froth ,
Mon 21 May 2012, 20:17,
archived )
People will get all confused and start thinking it's Sunday.
(
Fluffy elephants ,
Mon 21 May 2012, 20:22,
archived )
Real Photo Monday is shite. Give it up.
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:24,
archived )
"Don't be boring"?
(
Ghoti Fingers ,
Mon 21 May 2012, 20:23,
archived )
no one posting for an hour is more boring
(
HappyToast Groat froth ,
Mon 21 May 2012, 20:31,
archived )
^ this
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:33,
archived )
^ that
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:35,
archived )
^these
(
augsav forgot about B3ta ,
Mon 21 May 2012, 21:03,
archived )
It was mearly an whimsical excuse to publish this as I made today.
However, there is a section in the FAQ entitled 'Making and Posting Pictures", with the emphasis on making pictures as it goes on to describe where to source images from, then how to manipulate them and what to manipulate them on. Further to that, it is well known that "rps sunday is shit", implying that real photographs are generally tolerated on sunday, but is still considered not within the spirit. Or we can just turn into reddit.
(
Notorious P I G is deep undercover and reporting back on ,
Mon 21 May 2012, 20:25,
archived )
I think "RPS is shit give it up" mainly refered to how Sundays were basically Flickr for a while
with loads of arty pics of nothing funny. At least this raises a childish giggle.
(
HappyToast Groat froth ,
Mon 21 May 2012, 20:30,
archived )
'Real Photo Sunday Sunday is shit'
* I don't get it?
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:37,
archived )
There's also a 'Butts Retreat' near me
which is almost permanently vandalised into Butt Treat.
(
Notorious P I G is deep undercover and reporting back on ,
Mon 21 May 2012, 20:28,
archived )
hahahahaha
(
h3donist tryin' to play me out as if my name is Sega.. ,
Mon 21 May 2012, 20:22,
archived )
A FAQ animation larger than 400kb
You gotta larf
(
Richard Shitheels ,
Mon 21 May 2012, 20:47,
archived )
haha oh the ironing.
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 22:12,
archived )
what a twat
(
HappyToast Groat froth ,
Mon 21 May 2012, 22:20,
archived )
Very diversionary
(
Ghoti Fingers ,
Mon 21 May 2012, 20:17,
archived )
Heaven is like a dark void and a gif looped for all eternity.
(
patella ,
Mon 21 May 2012, 18:57,
archived )
Eraserhead wins to fuck! Easily some of the most disturbing stuff I've seen on film.
(
Hitler's Barber Soylent Green is high in saturated fat ,
Mon 21 May 2012, 19:03,
archived )
true
(
patella ,
Mon 21 May 2012, 19:10,
archived )
^this
(
Jahled Three shades of black ,
Mon 21 May 2012, 19:12,
archived )
I bought it on VHS in the 90s and have still never watched it
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:53,
archived )
foetal nastiness at its best
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 21:04,
archived )
Pure comedy.
I love it and the sound track (ninety minutes of mostly just varied white noise) does a lot more for me than it should for a healthy human being.
(
Smoked Oysters Yes, magick helmet! And I will give you a sample! ,
Tue 22 May 2012, 0:25,
archived )
that is fucking scary !!
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 19:27,
archived )
she had the developing jaw of a child
.
(
Zoidaroid ,
Mon 21 May 2012, 19:32,
archived )
Aaarrggghhh
that picture gives me the fucking fear thanks to my Trypophobia
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 19:38,
archived )
!
Is that real?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:52,
archived )
yes
it's what happened in all of us once
(
Zoidaroid ,
Mon 21 May 2012, 21:07,
archived )
happened to us all, such horror in our own heads
(
patella ,
Mon 21 May 2012, 20:00,
archived )
WTF is that!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 20:14,
archived )
(
HappyToast Groat froth ,
Mon 21 May 2012, 20:33,
archived )
Teeeeefs :D
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 20:29,
archived )
WOW fascinating model
'wants'
(
FeralCatMan Unusual disease collector. ,
Mon 21 May 2012, 20:56,
archived )
It has been agreed this is freaked out enough
To be awarded a Yhanthlei Order of Excellence You must be dead chuffed
(
Jahled Three shades of black ,
Mon 21 May 2012, 19:35,
archived )
I am dead
chuffed because it is the first award i ever got awarded
(
patella ,
Mon 21 May 2012, 19:42,
archived )
Have another one then, the R'lyeh Order of Merit:
(
Jahled Three shades of black ,
Mon 21 May 2012, 20:08,
archived )
great
a spare, in case i lose the first one
(
patella ,
Mon 21 May 2012, 21:19,
archived )
In my head she keeps saying "Pleeeease".
It's rather unsettling.
(
Fluffy elephants ,
Mon 21 May 2012, 19:39,
archived )
HAPPY CANDLE!!
(
Richard Shitheels ,
Mon 21 May 2012, 19:50,
archived )
Woohoo!
Thanks, I always ended up missing all my other ones.
(
Fluffy elephants ,
Mon 21 May 2012, 19:51,
archived )
CANDLES!!!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:53,
archived )
Happy Candles! :)
(
Jahled Three shades of black ,
Mon 21 May 2012, 20:23,
archived )
:D
(
Fluffy elephants ,
Mon 21 May 2012, 20:25,
archived )
BOLLOCKCHEEKS
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:52,
archived )
Happy Candleday to you as well!
Does this mean we're blood brothers?
(
Fluffy elephants ,
Mon 21 May 2012, 19:53,
archived )
well, not blood
unless we are too rough, then there might be some blood too
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:56,
archived )
happy candles fluffy and gruffi
now you know how it feels to be a twin and having to share all the birthday attention
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 20:03,
archived )
BUT I'M THE OLDEST ONE!
were you dressed the same?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:04,
archived )
I was an only twin
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 20:07,
archived )
conjoined?
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:10,
archived )
And I'm the younger angelic looking one who sits biting my own arm and then goes running to Rob, saying that you did it.
(
Fluffy elephants ,
Mon 21 May 2012, 20:12,
archived )
which means that afterwards, I will!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:16,
archived )
My brother used to do it but he had a gap between his two front teeth so it was always obvious.
(
Fluffy elephants ,
Mon 21 May 2012, 20:24,
archived )
so have I!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:34,
archived )
Argh! The universe is falling in on itself!
(
Fluffy elephants ,
Mon 21 May 2012, 20:51,
archived )
A friend of mine had to share his birthday with his older brother's 'half birthday'.
The brother's birthday was on December 27th so because it was so close to Christmas, exactly 6 months later they celebrated his half birthday by throwing a party on my friend's actual birthday. The brother still celebrated on the 27th too... Now, that's quite shitty parenting really.
(
Fluffy elephants ,
Mon 21 May 2012, 20:09,
archived )
Fuck, sorry I seem to have thought this was QOTW.
(
Fluffy elephants ,
Mon 21 May 2012, 20:10,
archived )
haha
that is quite shit
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:11,
archived )
Happy candle day...
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:39,
archived )
Well Happy Candles to the pair of you :)
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 21:04,
archived )
Blimey, copycat
(
Richard Shitheels ,
Mon 21 May 2012, 19:56,
archived )
I went back in time a year before Fluffy Elephants and joined up then
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:58,
archived )
looks like she's had the monkey testicle implants.
(
Thor_sonofodin has done things, terrible things on ,
Mon 21 May 2012, 20:01,
archived )
I'm quite happy with mine
although I keep getting the urge to masturbate in public
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:05,
archived )
don't we all...
Happy Candles!
(
RedHouse over yonder ,
Mon 21 May 2012, 20:09,
archived )
ba-dum-tish!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:12,
archived )
Oooooh. Freaky.
(
Chumps 👀 ,
Mon 21 May 2012, 20:05,
archived )
I always imagine his feathers to be turqois
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:21,
archived )
Turkies?
And happy candle thing day!
(
Chumps 👀 ,
Mon 21 May 2012, 20:24,
archived )
haha, turqoise
and ta
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 20:35,
archived )
(
Happosai _,,,,_(O ; o)_,,, ,
Mon 21 May 2012, 21:07,
archived )
ha ha headshape
(
patella ,
Mon 21 May 2012, 20:32,
archived )
Freaking out...
Eraserhead and Freaks in the same thread? Nooooooes!!! i blame these two films for totally screwing up my sex life...yup, can only shag in monochrome...seriously, I found both films had an undercurrent of frenzied eroticism....What? Just me then....
(
fucketybye CaCRocker ,
Mon 21 May 2012, 21:52,
archived )
moar keyboard, vicar?
(
maggenspies mayhaps ,
Tue 22 May 2012, 0:41,
archived )
Creepy.....
(
The invisable man Is having a long lazy soak in search ,
Mon 21 May 2012, 20:29,
archived )
hey
that is nice
(
patella ,
Mon 21 May 2012, 21:15,
archived )
nnnnggghh!
(
maggenspies mayhaps ,
Tue 22 May 2012, 0:58,
archived )
NOT SAFE FOR WORK...
Jack Nance (Eraserhead) in a saucy film (8 mins). It's only silly-sauce, though...REPEAT - NOT SAFE FOR WORK!!!
(
Jabberwoc misses D.R. and Quinch ,
Tue 22 May 2012, 21:51,
archived )
"You on the guest list ??"
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 17:47,
archived )
Pete the meet and greet
love this
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 17:55,
archived )
Saint Pete to you guv
:)
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 17:57,
archived )
Highbrow heaven
Lady's who die on a Tuesday get in free.
(
cowcat Bituminous squeegee ,
Mon 21 May 2012, 17:59,
archived )
Stupid rules
I didn't want to get into heaven anyways :D
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 18:00,
archived )
Nice one !
...sert wellies, watz them then!
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 18:00,
archived )
Desert wellies :-)
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:01,
archived )
Never heard them called that
had to look it up and everything!
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 18:05,
archived )
It's what one eats between the main wellies and the cheese wellies.
(
Ghoti Fingers ,
Mon 21 May 2012, 18:40,
archived )
Woo, that's great!
I bloody hate dress codes at clubs... I was recently turned away for wearing trainers while a hen-do party of girls all dressed as fairies happily sauntered in :/
(
The Silent Channel is getting his recommended 5-a-day ,
Mon 21 May 2012, 18:05,
archived )
there's a lesson there
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:11,
archived )
You can go anywhere in a tutu?
(edit: great pic, BTW)
(
Skotzmun Blah blah secret passage blah blah diamonds. ,
Mon 21 May 2012, 18:17,
archived )
ta
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:42,
archived )
meh, I wasn't the biggest fan of the club anyway
what was worse for me was because I was the only member of the group wearing trainers my mere presence meant EVERYBODY had to go somewhere else (in this case an Irish pub next door) I couldn't quite believe me wearing a simple pair of trainers had completely derailed a planned night out... I felt mortified in the pub and it's easily one of the biggest faux pas I've ever made. But I'm sure there'll be others soon.
(
The Silent Channel is getting his recommended 5-a-day ,
Mon 21 May 2012, 19:00,
archived )
Hey, that happened to me on Saturday...
...except it was one of the other guys wearing the trainers, and after being turned away from the mediocre club we ended up at a truly dire one instead.
(
EvilTerran rearranged his letters on ,
Mon 21 May 2012, 21:39,
archived )
It's a bit archaic
Especially when they can refuse the right to admission anyway. "why can't I come in" ? "because" the end
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 18:16,
archived )
I quite like dress codes
It's an excuse to get the glad-rags on.
(
TheSundaeLunch I'm a fucking shrub, alright? ,
Mon 21 May 2012, 18:27,
archived )
this
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:43,
archived )
Somehow I doubt it
Woo!
(
TheSundaeLunch I'm a fucking shrub, alright? ,
Mon 21 May 2012, 18:12,
archived )
:)
long time no speaky !!
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:43,
archived )
I've been lurking a lot
:)
(
TheSundaeLunch I'm a fucking shrub, alright? ,
Mon 21 May 2012, 19:29,
archived )
"NO SANDALS, YER NOT COMING IN"
"oh.. sorry Jesus" *punch* "I SAID NO FUCKING SANDALS"
(
discomeats This canoe ,
Mon 21 May 2012, 18:29,
archived )
he looks like brian moore
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 18:48,
archived )
you tell him
(
The Twisted Omentum vidi vici veni ,
Mon 21 May 2012, 18:54,
archived )
Saint Peter in satin - he's like Buddha with Mace.
(
Captain Howdy ,
Mon 21 May 2012, 18:48,
archived )
no mobile phones
no walkmans, none of those or any of the other things end black books quote
(
Dont point it at your face up the ass ,
Mon 21 May 2012, 19:00,
archived )
Everyone will be smartly dressed
but smell of cheap perfumes.
(
Fluffy elephants ,
Mon 21 May 2012, 19:41,
archived )
happy candle something
(
custard ,
Mon 21 May 2012, 19:44,
archived )
Yay! Candleday!
Cheers. :D
(
Fluffy elephants ,
Mon 21 May 2012, 19:52,
archived )
Gadd help us all
(
partyboy. Sick, and proud of it. ,
Mon 21 May 2012, 16:55,
archived )
Gaddzooks
(
Elvis impersonator ,
Mon 21 May 2012, 17:04,
archived )
that's aPauling :)
(
Zoidaroid ,
Mon 21 May 2012, 19:43,
archived )
But does it have some sort of secreted resin?
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 17:31,
archived )
He comes at night... mostly.
(
discomeats This canoe ,
Mon 21 May 2012, 18:25,
archived )
ARGH!
(
Griffin Saver Something, something, 2006, something. ,
Mon 21 May 2012, 19:54,
archived )
^ GlitterLols
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 17:43,
archived )
I did a load a sketches over the weekend. Need to make an art dump.
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:45,
archived )
..talking of dumps....
brb
(
Elvis impersonator ,
Mon 21 May 2012, 16:47,
archived )
them's good plips
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:48,
archived )
being careful you that not shed by water.
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:48,
archived )
That's......cryptic.
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:50,
archived )
Sorry for my bad Engrish.
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:51,
archived )
Almost...........
sorry solly
(
Chumps 👀 ,
Mon 21 May 2012, 16:53,
archived )
Nnnnng!
Nnng! Nnnnnnnnnnngh! *sploosh*
(
Doctor When May your wife shat and chipper ,
Mon 21 May 2012, 16:52,
archived )
"Depth charge"?
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:53,
archived )
ALAAAAAAAAAAAAAAAAAAAAARRRRMMM!
(
Doctor When May your wife shat and chipper ,
Mon 21 May 2012, 16:57,
archived )
Plip Plops
(
Chumps 👀 ,
Mon 21 May 2012, 16:55,
archived )
I do prefer your sketches to the finished art
there's far more energy to them. Same applies to most comic artists really
(
HappyToast Groat froth ,
Mon 21 May 2012, 17:00,
archived )
This person is telling me the same thing.
I think no matter. Never mind.
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:06,
archived )
Apart from Moggy
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 17:07,
archived )
haha
(
maiden is filmed before a live studio audience ,
Mon 21 May 2012, 18:14,
archived )
Sketches always feel more dynamic, but they're very hard to alter.
For large-scale, finished projects, I prefer going digital, as I can scale/move things around, making the whole process faster than if I were constantly redrawing something with pencil and paper. (which, given the absurd proportions some of my sketches have, is often a requirement).
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 17:14,
archived )
*Agree*
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:20,
archived )
Yes, whatever it was he said.
(
Michael Ellis contributes nothing ,
Mon 21 May 2012, 17:34,
archived )
Well I guess it's true what they say.
Big things come in small packages *Brady bunch stock montage sequence aaaaaaand cut to credits*
(
cenaris Is dividing 3 by waffle ,
Mon 21 May 2012, 17:17,
archived )
I like the chick with the big gun and also the chick with the small gun
they should have adventures that benefit from the use of a variety of guns. At least I think the chick with big gun has a big gun, it could be a space hoover, from space.
(
discomeats This canoe ,
Mon 21 May 2012, 18:31,
archived )
Lovely stuffs,
that vampire neck wear must get a bit uncomfortable.
(
Fluffy elephants ,
Mon 21 May 2012, 19:44,
archived )
Lovely sketches :)
I feel an artists' true colours come through in development sketches, rather than the final piece.
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 23:19,
archived )
Limpet
Its not obscene!
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:22,
archived )
Open the floodgates
(
claptonista ,the idiot boy..........🫥 ,
Mon 21 May 2012, 16:24,
archived )
Yes
That's what I believe the image is saying
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 17:20,
archived )
minge de limon
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:24,
archived )
It does lok like a rather citrusy clunge.
(
Captn Hood-Butter is not dead yet. ,
Mon 21 May 2012, 16:31,
archived )
I read that as "crusty flange"
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 16:32,
archived )
That works too.
(
Captn Hood-Butter is not dead yet. ,
Mon 21 May 2012, 16:33,
archived )
and there you go...
my 'ignore' list has started again
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 16:25,
archived )
Why? :3
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:29,
archived )
I don't know.
Maybe it's a clash of artistic styles or maybe you got us his hooter via his bumhole. I wouldn't worry Dave, there's loads more where he came from.
(
Captn Hood-Butter is not dead yet. ,
Mon 21 May 2012, 16:36,
archived )
U NO FILTAD!
XD
(
RedHouse over yonder ,
Mon 21 May 2012, 16:39,
archived )
Wobbly likes CDC's
and this hasn't got one...
(
Elvis impersonator ,
Mon 21 May 2012, 16:41,
archived )
^ This
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 17:43,
archived )
Oh /do/ fuck off
(
TheCastrator ,
Mon 21 May 2012, 16:27,
archived )
Nice limpet
(
Wasp Box like a nervous random stranger at a glory hole ,
Mon 21 May 2012, 16:28,
archived )
Thank you ^^
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:39,
archived )
(
Captn Hood-Butter is not dead yet. ,
Mon 21 May 2012, 16:28,
archived )
bisc limpet is my favourite band
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 16:30,
archived )
I don't get the hostility up there
she's actually posted something that isn't mental that I immediately have to hide from my boss
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:30,
archived )
I reckon they think it's a bit big and clever to have a pop at Moggy.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 16:35,
archived )
maybe they've been getting the same emails from her all afternoon that I have
(
HappyToast Groat froth ,
Mon 21 May 2012, 16:36,
archived )
Why?!!! XD
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:37,
archived )
^
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:37,
archived )
Posted is this to your site for deviants?
For I here I can not view it.I haven't had to hide anything from my bosses for ages and don't want to miss out...
(
XLVII .uk ,
Mon 21 May 2012, 16:36,
archived )
Limpets are rubbish.
Draw a bearded clam instead.
(
Chumps 👀 ,
Mon 21 May 2012, 16:37,
archived )
Shaggy beard....
XD
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:44,
archived )
Shaved snapper.
(
Captn Hood-Butter is not dead yet. ,
Mon 21 May 2012, 16:46,
archived )
red snapper?
(
discomeats This canoe ,
Mon 21 May 2012, 18:26,
archived )
I bet that tastes tart.
(
edjogs Collared doves are shit. ,
Mon 21 May 2012, 16:41,
archived )
"One that clings persistently to another"
(
Captain Howdy ,
Mon 21 May 2012, 16:41,
archived )
XD
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 16:42,
archived )
hahahahaha
(
HappyToast Groat froth ,
Mon 21 May 2012, 16:43,
archived )
pfffft
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:47,
archived )
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:47,
archived )
Pff - thats your answer to everything!
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:47,
archived )
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 16:48,
archived )
now do bemusement
(
HappyToast Groat froth ,
Mon 21 May 2012, 17:01,
archived )
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 17:10,
archived )
I think you'll find that's "cock joy"
(
HappyToast Groat froth ,
Mon 21 May 2012, 17:10,
archived )
No. You can quite clearly see "Bemusement", there.
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 17:15,
archived )
Maria: *Retrieve a scissors*
me: Jack!! Watch out!! :O
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:17,
archived )
christ, if that keyboard wasn't waterproof it is now
(
discomeats This canoe ,
Mon 21 May 2012, 18:34,
archived )
Not at all :D
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 16:53,
archived )
(
Doctor When May your wife shat and chipper ,
Mon 21 May 2012, 16:53,
archived )
Hello :D
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:07,
archived )
fffffff
(
macroscian (1 like) ,
Mon 21 May 2012, 17:21,
archived )
:D
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:23,
archived )
Canitbelicked
MybrotherandIusedtochewlimpetswhenwewentfishingaskidsbecauseourmumwouldn'tletushavechewinggumdoyoueatrawlimpets?
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 17:49,
archived )
Wow XD
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 17:53,
archived )
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 17:54,
archived )
Phwoar
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 17:55,
archived )
8D Hahaha!!!
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 18:01,
archived )
that's gotta suck!
*cough* edit: also, people just see things :)
(
discomeats This canoe ,
Mon 21 May 2012, 18:26,
archived )
Hahaha XD
Magic!!
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 18:33,
archived )
Heaven Is A VCR (circa '79)
Unquestionable Performance.
(
SpiteClassic ,
Mon 21 May 2012, 16:13,
archived )
I dont get it
but i likes the Bettie Page pic
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:20,
archived )
Phwoar
(
spazzcaptain Misses Valin @ ,
Mon 21 May 2012, 16:28,
archived )
I enjoyed that film
I actually thought the actress who played Bettie was more attractive that Bettie herself!
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:30,
archived )
^this^
excellent casting, and fascinating to see the real woman behind the pictures
(
RedHouse over yonder ,
Mon 21 May 2012, 16:38,
archived )
Yup.
I pretty much owe my career to that lass, since im known for doing pinup art, and she pretty much invented it.
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 16:44,
archived )
Me too.
(
LordManley twitter.com/LordManley ,
Mon 21 May 2012, 16:38,
archived )
tour de france :)......don't think I've posted this before
search says nein...then again the first that comes up is grand national!@#$%^^&
(
Elvis impersonator ,
Mon 21 May 2012, 15:56,
archived )
it's very familiar
maybe there was just one tortoise before
(
HappyToast Groat froth ,
Mon 21 May 2012, 15:57,
archived )
are those mini penny farthings or fucking massive turtles?
woo! edit: nein? I only count three :)
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 15:58,
archived )
Ha ha ha, very much this!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 16:25,
archived )
CONGRATULATIONS!
This outstanding contribution to Anglo-Franco amphibian cycling relations has won you a b3ta Psittaculidae Toothbrush Club Award of Excellence!! You must be thrilled to bits! :)
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:13,
archived )
huzzah :D
(
Elvis impersonator ,
Mon 21 May 2012, 16:13,
archived )
The awards committee are a tough lot to impress
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:21,
archived )
What the..................!!
(
spazzcaptain Misses Valin @ ,
Mon 21 May 2012, 16:30,
archived )
Ah, you must have been left off the shortlist for club membership
They are a secretive bunch
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:33,
archived )
Dammit!
***Cries*** Next year maybe.
(
spazzcaptain Misses Valin @ ,
Mon 21 May 2012, 16:37,
archived )
(
harold shipmans surgery dances with patients, the wolves were on holiday ,
Mon 21 May 2012, 17:52,
archived )
why is this making me feel a bit ill?
(
Smash Monkey lowering the tone of the whole internet ,
Mon 21 May 2012, 16:15,
archived )
Never mind THEM.......
YOU need a drugs test. :)
(
Chumps 👀 ,
Mon 21 May 2012, 16:44,
archived )
I'll test any drugs they gimme :D
(
Elvis impersonator ,
Mon 21 May 2012, 16:54,
archived )
weee :D
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 17:43,
archived )
i yam in a box
(
HappyToast Groat froth ,
Mon 21 May 2012, 14:51,
archived )
Hahaha
This is great :D
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 14:52,
archived )
Ha ha ha ha!
He looks like he's in a quandary.
(
Smallbrainfield ,
Mon 21 May 2012, 14:57,
archived )
He knows that it's becoming quite urgent
that he gets out of the box and makes the long journey to the litter tray
(
fuscous ,
Mon 21 May 2012, 15:02,
archived )
And if he leaves the box now,
some other bugger will have nicked it before he gets back...
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 16:32,
archived )
I yam in a box watching u masturbate....
(
Elvis impersonator ,
Mon 21 May 2012, 14:58,
archived )
pffft, noice teefs
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:58,
archived )
(
HappyToast Groat froth ,
Mon 21 May 2012, 15:00,
archived )
:D
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 15:03,
archived )
HGNNNHHHHGGGGGGGGH
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 15:15,
archived )
Hahaha!
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:21,
archived )
Looks a bit like a critter
Or what my terrible memory has turned critters into..... Woo!
(
XLVII .uk ,
Mon 21 May 2012, 15:01,
archived )
Hahaha
you know me and cat pictures, but this is excellent
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 15:02,
archived )
very high praise :D
(
HappyToast Groat froth ,
Mon 21 May 2012, 15:05,
archived )
The mouth is from those blow job pics, yeah?
I wondered when we would start seeing these in 'shops on here :-)
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 15:15,
archived )
yeah, been sat on my desktop for a while
surprised no one had been through them sooner
(
HappyToast Groat froth ,
Mon 21 May 2012, 15:21,
archived )
Neargh!
(
Captain Howdy ,
Mon 21 May 2012, 15:03,
archived )
(
HappyToast Groat froth ,
Mon 21 May 2012, 15:04,
archived )
Those eyes...
What otherworldly horrors have they witnessed? 0_0
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 15:14,
archived )
The rare sumatran screamer ape
(
taters Bah weep grahnah weep ninibong ,
Mon 21 May 2012, 15:16,
archived )
I recognise those teeth from the newsletter
blow job photos just got funnier
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 15:06,
archived )
Maru's starting tto look a bit rough.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 15:21,
archived )
:D
(
Mr. Oleary MAKE MONEY FAST $$$ ,
Mon 21 May 2012, 16:03,
archived )
Healthy-looking teeth for a pirate
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 16:22,
archived )
and you can fucking stay in there
(
Smash Monkey lowering the tone of the whole internet ,
Mon 21 May 2012, 15:51,
archived )
hahahaha what an expression
That works so well.
(
spazzcaptain Misses Valin @ ,
Mon 21 May 2012, 15:54,
archived )
I feel like this.
(
2 Can Chunder Word to your mums, I came to prod bums ,
Mon 21 May 2012, 16:03,
archived )
I have no idea why this is funny
But I am laughing like a moron on crack. Well done you! *edit* fuck it I've made this my desktop wallpaper so I can have a laugh every morning! Love it! :D When can I get the poster?
(
..wil ,
Mon 21 May 2012, 19:27,
archived )
yaaaaaaaaaaahhhhhhhhh
(
h3donist tryin' to play me out as if my name is Sega.. ,
Mon 21 May 2012, 19:29,
archived )
haha
funny
(
Zoidaroid ,
Mon 21 May 2012, 19:41,
archived )
Afternoon, shandybandits!
Lunchbreak random mindpiss: Love, Dr. When.
(
Doctor When May your wife shat and chipper ,
Mon 21 May 2012, 13:58,
archived )
but can it go upstairs?
woo
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:01,
archived )
I like driving in my carlek
Beepbeep beepbeep beepbeep barlek!
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 14:02,
archived )
not a Queen fan...but this was a good track:
(
Elvis impersonator ,
Mon 21 May 2012, 14:19,
archived )
nifty edit on your pic btw :D
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:38,
archived )
:)...thought "may as well"
sat here twiddling thumbs (2) :D
(
Elvis impersonator ,
Mon 21 May 2012, 14:45,
archived )
Woo
:D
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 14:26,
archived )
That would be ace car to be in in a traffic jam
(
Jahled Three shades of black ,
Mon 21 May 2012, 16:22,
archived )
It has competition...
Not my photo, but the only one I could find on t'internet...www.flickr.com/photos/steveroe/13540222/
(
Captain Coffee Break ,
Mon 21 May 2012, 23:01,
archived )
Looking further...
(
Captain Coffee Break ,
Mon 21 May 2012, 23:12,
archived )
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:29,
archived )
cor!
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:29,
archived )
uscant
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:41,
archived )
:D cool
*click* for inventive
(
Elvis impersonator ,
Mon 21 May 2012, 13:29,
archived )
cheers :)
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:42,
archived )
Yay!
They have developed fiendish cunning
(
Jahled Three shades of black ,
Mon 21 May 2012, 13:31,
archived )
and the souls of orangels
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:43,
archived )
Orycteropus Hesperidium.
(
Captain Howdy ,
Mon 21 May 2012, 13:33,
archived )
precisely?
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:45,
archived )
:D
Very nicely animated
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:33,
archived )
ta :)
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:45,
archived )
Well thats a bit good!
(
Victor Meldrew ,
Mon 21 May 2012, 13:34,
archived )
:D
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:46,
archived )
Sterling work
(
fuscous ,
Mon 21 May 2012, 13:39,
archived )
fanx :)
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:47,
archived )
Nuts!
And nice bowling action Moses
(
Q4nobody ,
Mon 21 May 2012, 13:41,
archived )
he don't roll on shabbas
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:49,
archived )
Very nice indeed!
(
Wasp Box like a nervous random stranger at a glory hole ,
Mon 21 May 2012, 13:49,
archived )
o/
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:53,
archived )
Smashin'!
(
Chumps 👀 ,
Mon 21 May 2012, 14:27,
archived )
pumpkins!
pumpkins! oranges!
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:33,
archived )
Wicked animation there
well done
(
mcmike Messed his pants badly on ,
Mon 21 May 2012, 21:59,
archived )
It is the last day of my holidays and I'm looking for something fun to draw this afternoon but I am lacking inspiration
As per Drunken Miss Muffet's suggestion Ben Fogle wrestling with an elderly tortoise
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:09,
archived )
The death of irony.
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:10,
archived )
That's a tough one
I could draw Alanis Morissette being beaten to death with 10000 spoons instead.
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:14,
archived )
*Gets TRFH*
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:15,
archived )
TRFH?
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:18,
archived )
Testicle rifle for hire
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:20,
archived )
Tuscan Raider's Furry Honeytrap.
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:21,
archived )
The red footed hen
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:25,
archived )
Thank rascals for hodlums
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:28,
archived )
Tom Reynolds fingered Hayley
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:31,
archived )
I've been a hummus-free zone for days now.
Some would say years, but that would be uncharitable.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 13:11,
archived )
I would not say days, just mere moments.
Several long, tedious moments.
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:14,
archived )
So are we.
Good luck on your mission.
(
Captain Howdy ,
Mon 21 May 2012, 13:13,
archived )
Tits with tits with tits with tits
with tits on top of the tits with tits with tits with tits
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 13:14,
archived )
^With added tits^
(
Je suis un vagabond is an unfunny, up your own arse middle class knob ,
Mon 21 May 2012, 13:14,
archived )
hrmm
smexy
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:17,
archived )
I just watched last nights Channel 4 comedy thing
the prolonged unfunny standup has left me hummusless
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:19,
archived )
Did you clock this earlier?
www.b3ta.com/board/10772621 Not sure if it's 100% your bag but might be an interesting thing to look at.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 13:22,
archived )
I did yes, and have sent him a link to my website on the freakish chance it's the sort of thing he's after
cheers
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:29,
archived )
Oh great another person wasting a thread, hoping for fawning comments.
Make sure you don't respond to anyone's comments when you've posted it! LOL
(
Victor Meldrew ,
Mon 21 May 2012, 13:20,
archived )
don't be nasty to him,
being nasty is worse than wasting threads
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:21,
archived )
no do be nasty
this place has gone right down hill with people not being nasty like we used to
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:21,
archived )
this place is so nasty now
it was never like this in the good old days
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:21,
archived )
etc
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:21,
archived )
XD Thanks!
(
Victor Meldrew ,
Mon 21 May 2012, 13:23,
archived )
Is thread wasting really so much of a problem with the board moving as slowly as it is?
The image I posted yesterday is still on the bottom of the board.
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:24,
archived )
They say he carved it from a bigger spoon..
(
Captain Howdy ,
Mon 21 May 2012, 13:27,
archived )
yes it's inherently evil, you'd better delete this thread
NO! don't delete the thread, that's worse than holocaust aids But there's nothing in the faq to say not to and the site was designed with a delete button, surely to be used? That's not important right now my own personal FAQ is the one you should be following etc
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:27,
archived )
To be fair, its a waste that gets a lot more response than half the shit i spend hours photoshopping so fair enough!
(
Victor Meldrew ,
Mon 21 May 2012, 13:31,
archived )
yep, that's totally how it works here
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:33,
archived )
draw a hot chick with a sword
fighting robotic ninjas
(
discomeats This canoe ,
Mon 21 May 2012, 13:21,
archived )
or draw a robotic chicken with a ninja
fighting hot swords
(
HappyToast Groat froth ,
Mon 21 May 2012, 13:22,
archived )
with tits!
(
discomeats This canoe ,
Mon 21 May 2012, 13:23,
archived )
I recommend that draw to something yummy cakes. :)
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 13:22,
archived )
a hot chick with yummy cakes!
and a sword
(
discomeats This canoe ,
Mon 21 May 2012, 13:29,
archived )
XD
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 13:36,
archived )
A hot sword-swallower
with a yummy sword
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 13:56,
archived )
A queue of strapping great rugby players
taking it in turns to do your mum up the arse
(
emvee cruor deo cruoris ,
Mon 21 May 2012, 13:23,
archived )
^actually this
but they must all have rabbit ears and big tits
(
Jahled Three shades of black ,
Mon 21 May 2012, 13:30,
archived )
oh hai J"what shall I draw 'th day"J
:)
(
Elvis impersonator ,
Mon 21 May 2012, 13:24,
archived )
I did think about entitling it "bobby bob bob's pale imitation of JollyJack's cartoon time"
but I thought it would be self evident
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:26,
archived )
:D
(
Elvis impersonator ,
Mon 21 May 2012, 13:27,
archived )
A robot giving birth
or Ben Fogle wrestling with an elderly tortoise
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 13:25,
archived )
In retrospect
maybe with Fred written on her back in emulsion
(
fuscous ,
Mon 21 May 2012, 14:36,
archived )
A hyena wearing a gorilla suit lying in a hammock juggling three aubergines, in the middle of Oxford Street on a busy Saturday afternoon
added rabbit ears and tits entirely up to you
(
Jahled Three shades of black ,
Mon 21 May 2012, 13:28,
archived )
pretty much a typical Oxford street scene really
(
discomeats This canoe ,
Mon 21 May 2012, 13:29,
archived )
Last night I had a dream I met George Osborne
I told him he needed to get some better PR because everyone thought he was a complete dick. Draw that.
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 13:29,
archived )
count duckula slowly fisting dangermouse while wanking him off into dogtanian's face.
(
mark morrisons prison shoes I love Willie ,
Mon 21 May 2012, 13:39,
archived )
I usually spend the last day of holidays indulging in the sport of kings*
* going down the pub at lunchtime and drinking all afternoon
(
fuscous ,
Mon 21 May 2012, 13:49,
archived )
a man-sized bacterium
with several engorged flagella questing blings for the stinking, batter encrusted muffhole of the naked baglady who is lying on a park bench languidly frotting herself with a bottle of holstein pils.
(
Wasp Box like a nervous random stranger at a glory hole ,
Mon 21 May 2012, 13:49,
archived )
Brass rubbings
(
macroscian (1 like) ,
Mon 21 May 2012, 14:23,
archived )
HIS ASS
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:31,
archived )
Thanks Bobby
There is a story behind that idea. Someone once sent a clipping from a TV guide to Private Eye, reading "Animal Park: An elderly tortoise fights for its life. With Ben Fogle."
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 14:35,
archived )
haha
I love stuff like that :D
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 14:38,
archived )
Right in the mufflon
(
macroscian (1 like) ,
Mon 21 May 2012, 14:36,
archived )
Blonde pole-limpits.
(
JollyJack - a stench from the past ,
Mon 21 May 2012, 15:17,
archived )
I want...
...a monkey wearing a cowboy hat and riding a tricycle. But it must be animated!
(
minimalist ... ,
Mon 21 May 2012, 15:29,
archived )
4eva
(
Elvis impersonator ,
Mon 21 May 2012, 12:58,
archived )
Barry absorbed both their life forces in an arcane ritual to prolong his own miserable existence.
(
Captain Howdy ,
Mon 21 May 2012, 13:07,
archived )
What an arse
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 13:36,
archived )
Highlander?
There can be(e gees) only one!
(
Haku Orange Whip? Orange Whip? Three Orange Whips. ,
Mon 21 May 2012, 14:22,
archived )
The Bee Gees sing on the Howard Stern Show: www.youtube.com/watch?v=CYq05-RAhyg .
(
Haku Orange Whip? Orange Whip? Three Orange Whips. ,
Mon 21 May 2012, 11:02,
archived )
Lest we forget...
Meaningless Songs In Very High Voices oh, and very good, Haku - Barry wins The Brothers
(
Fat Boab of dailyreckless.com fame ,
Mon 21 May 2012, 11:06,
archived )
"One day I'm gonna lift the cover and look inside your heart"
In order to rule out arterial sclerosis as the cause of death...
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 11:11,
archived )
Ha ha ha ha....
^ A I am ashamed that I laughed at that.
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 11:18,
archived )
Looks at the news
quickly checks b3ta to see the lols
(
Paul_P http://www.Paul-hub.com ,
Mon 21 May 2012, 11:23,
archived )
(
#1 ,
Mon 21 May 2012, 11:37,
archived )
other's still dead then?
(
Elvis impersonator ,
Mon 21 May 2012, 11:37,
archived )
See also:
Gaddafi Osama Sadam Rdli Hakkis Michael Jackson Tony Hart Gary Coleman David Hasselhoff Jade Goody The Pope The Thames Whale Mother Teresa Diana etc etc etc
(
Mu Dinofiddler ,
Mon 21 May 2012, 12:11,
archived )
You missed out Kim Jong Poorly
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:20,
archived )
Oh snap.
Well, at least he's not so ronery anymore
(
Mu Dinofiddler ,
Mon 21 May 2012, 12:22,
archived )
Thank God that John Peel's still going.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 13:12,
archived )
RDLI!
(
emvee cruor deo cruoris ,
Mon 21 May 2012, 13:27,
archived )
4 eva in the hartz of disco kittehs
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 11:59,
archived )
Looks like he's starting to flag in a very long dance marathon
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:23,
archived )
The catnip's starting to wear off
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 12:33,
archived )
Have a totally related pea
(
likeajackhammer ,
Mon 21 May 2012, 12:06,
archived )
Is it any surprise it's the giant Bee Gee who's still alive?
He clearly took all the good genes for himself.
(
Mu Dinofiddler ,
Mon 21 May 2012, 12:08,
archived )
Like The Beatles, they are dying in reverse order of how obnoxious they are
(I'm judging this largely on the Clive Anderson interview)
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:22,
archived )
DO NOT ANGER THE GIANT BEEGEE!
(
Mu Dinofiddler ,
Mon 21 May 2012, 12:23,
archived )
BBIG GIBB!
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:25,
archived )
They'll always be Les Tosseurs, to me.
(
Captain Howdy ,
Mon 21 May 2012, 12:52,
archived )
4eva in are harts
(
UTB ,
Mon 21 May 2012, 12:53,
archived )
You cannot kill what does not live!
(
Captain Howdy ,
Mon 21 May 2012, 12:57,
archived )
Your "HOWDY" tag
looks like "HOMO"
(
RedHouse over yonder ,
Mon 21 May 2012, 16:35,
archived )
lol
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 16:36,
archived )
4 eva.....
:)
(
XLVII .uk ,
Mon 21 May 2012, 13:15,
archived )
Ha-ha!
(
Captain Howdy ,
Mon 21 May 2012, 13:18,
archived )
(
discomeats This canoe ,
Mon 21 May 2012, 13:22,
archived )
I can't see this from the mirror I'm on :(
Bloody open dns shite they're running at work!
(
XLVII .uk ,
Mon 21 May 2012, 14:12,
archived )
it could be the Freegees
(
UTB ,
Mon 21 May 2012, 13:29,
archived )
that's as bad as mine :)
(
Elvis impersonator ,
Mon 21 May 2012, 13:34,
archived )
*chuckle*
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:02,
archived )
Hahahaha!
(
R.Soul hmmm ,
Mon 21 May 2012, 17:37,
archived )
Twitter will tweet itself
(
Fat Boab of dailyreckless.com fame ,
Mon 21 May 2012, 9:36,
archived )
We need a new Gulf War
All the characters from the last two are dying off.
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 9:41,
archived )
Were the BeeGees in the Gulf War?
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:27,
archived )
I thought they started it, didn't they?
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 12:30,
archived )
I thought that was the Falklands?
(
Photoshop Bitch 2014 edition ,
Mon 21 May 2012, 12:42,
archived )
The Falklands started the Gulf War?
And after all we've done for them...
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 16:22,
archived )
Nice.
Also - near the top - seems the Grauniad are looking for a comic illustrator: Via #thattheretwitter: Michael Holden @thewrongwriter "Still looking for a comic illustrator for new thing - last one ran for six years www.guardian.co.uk/culture/series/michaelholdensallears pls RT" Surely some of the folk from here are up for that?
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 10:11,
archived )
One thing I miss about the Guardian is Steve Bell
and the standard of comic illustrations in general. The equivalent in the Independent is rubbish in comparison
(
Jahled Three shades of black ,
Mon 21 May 2012, 10:35,
archived )
What? Something happened?
Someone from the B-52s killed Fred Bassett?
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 10:50,
archived )
something is always happening
except the gayshift. so i'll drop this here
(
polished turd 404 pixels wide ,
Mon 21 May 2012, 10:53,
archived )
Has anybody seen
A dog died gone green?/poetic license
(
fuscous ,
Mon 21 May 2012, 11:55,
archived )
I recognise that sig
I'll just put you in a coma with some dirty love
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 12:04,
archived )
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 11:43,
archived )
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 11:48,
archived )
hahaha which one is Mr Pink ?
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 11:52,
archived )
Second left has a faintly Buscemi-esque look to him.
(
barryheadwound Mul-ti-pass? Multipass! ,
Mon 21 May 2012, 13:13,
archived )
Hur huh-huh-huh hur hur.
We're gonna crash.
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 11:54,
archived )
The moon on a stick
Click for bigger Bonus painting done for the London Bash/Live Auction this weekend. If you can't make it and want to bid on it, gaz me your best offer
(
HappyToast Groat froth ,
Mon 21 May 2012, 9:18,
archived )
is he going to slide on to that?
'ning toasty!
(
Thor_sonofodin has done things, terrible things on ,
Mon 21 May 2012, 9:23,
archived )
if his grip goes, quite likely
(
HappyToast Groat froth ,
Mon 21 May 2012, 9:25,
archived )
BOTTOM NIPPLES!
(
Victor Meldrew ,
Mon 21 May 2012, 9:24,
archived )
Why do I have a Waterboy's song in my head now>
Woo and 'ningles all. I may also be putting a live webcam up on the night.
(
riverghost servicing your mum since ,
Mon 21 May 2012, 9:34,
archived )
'The Hole of the Moon'?
or 'Further Up, Further In'?
(
joefish It's hard for thee to kick against the pricks ,
Mon 21 May 2012, 11:09,
archived )
that's no moon
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 10:23,
archived )
Stargate: Arse-lantis
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 10:45,
archived )
Uranus!
if they are caught in its ring they are done for!
(
discomeats This canoe ,
Mon 21 May 2012, 12:04,
archived )
bummer
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 12:10,
archived )
look out for ass blasters
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 14:12,
archived )
Nice arse.
(
Captain Howdy ,
Mon 21 May 2012, 12:54,
archived )
(
drimble he'd been white, he'd been black ,
Mon 21 May 2012, 23:59,
archived )
Nice one
:D
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 13:11,
archived )
haha, is he playing golf?
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 13:55,
archived )
Gasmask friends
I just sketching.
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 2:18,
archived )
"Are you my mummy?"
(
Tahkcalb ω∞ for sigs ,
Mon 21 May 2012, 2:22,
archived )
Oh nice. cutie. :)
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 2:28,
archived )
Maria: Not mummy, zombie!
greykid man 1: ROFLZ!! ! greykid man 2: LOLZ!
(
Tahkcalb ω∞ for sigs ,
Mon 21 May 2012, 2:42,
archived )
XD hahaha!!
Exactly.
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 2:45,
archived )
Arf!
(
An Egg ,D ,
Mon 21 May 2012, 2:35,
archived )
(
TheSundaeLunch I'm a fucking shrub, alright? ,
Mon 21 May 2012, 2:50,
archived )
(
Tahkcalb ω∞ for sigs ,
Mon 21 May 2012, 2:52,
archived )
(
Extinct Jesus Dossier "...I think it counteracts Hitler's magic..." ,
Mon 21 May 2012, 8:39,
archived )
(
discomeats This canoe ,
Mon 21 May 2012, 12:16,
archived )
fuck off with your incomplete pics
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 2:52,
archived )
* ning real
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 6:16,
archived )
ning WB
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 8:28,
archived )
I started this, just sketching.
(
HappyToast Groat froth ,
Mon 21 May 2012, 7:19,
archived )
Much better than that shit up there ^
(
addickted has attained freedom ,
Mon 21 May 2012, 7:35,
archived )
I feel this one has more potential
(
HappyToast Groat froth ,
Mon 21 May 2012, 7:36,
archived )
But don't overcook it Toasty.
Remember - less is more.
(
Chumps 👀 ,
Mon 21 May 2012, 7:43,
archived )
i'm not sure if incomplete pics will have the same impact and longevity as fall fasion jokes
i'll just wait and see if i'm to be proved wrong
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 8:30,
archived )
Here you go I finished it for you
(
Bobby Bob Bob also available on http://jbobw.deviantart.com/ ,
Mon 21 May 2012, 8:01,
archived )
Ha ha ha - This wins everything!
(
Wobbly Bloke Hello, did I miss anything on ,
Mon 21 May 2012, 8:21,
archived )
FAKE! Knob's too big! :D
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 8:23,
archived )
looks about right to me
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 8:29,
archived )
nice pencilling skills
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 8:31,
archived )
very good
(
HappyToast Groat froth ,
Mon 21 May 2012, 8:50,
archived )
he's captured your style quite admirably
(
discomeats This canoe ,
Mon 21 May 2012, 12:05,
archived )
Ha, ace!
(
Wasp Box like a nervous random stranger at a glory hole ,
Mon 21 May 2012, 9:53,
archived )
hahaha
(
Q4nobody ,
Mon 21 May 2012, 9:04,
archived )
You realise you now have to finish this?
(
Mu Dinofiddler ,
Mon 21 May 2012, 9:08,
archived )
play nice!
(
prodigy69 broke b3ta and made everyone leave ,
Mon 21 May 2012, 8:24,
archived )
Pardon me, but I'm going to bed, and this isn't worth the space it takes up.
(
cowcat Bituminous squeegee ,
Mon 21 May 2012, 6:10,
archived )
I can't wait to show this to all my gasmask friends
(
mediocre ha ha ha, you're reading this ,
Mon 21 May 2012, 7:15,
archived )
The first thing I saw
was Maria holding The Fox by one of those collar on a long stick type things. Yeah, my head goes straight to that.
(
Smoked Oysters Yes, magick helmet! And I will give you a sample! ,
Mon 21 May 2012, 7:23,
archived )
Alright Dave!
I finished it for you! Hope you like it.
(
Chumps 👀 ,
Mon 21 May 2012, 7:54,
archived )
ha ha!
(
real i'm not happy 'til you're not happy ,
Mon 21 May 2012, 8:37,
archived )
I have a sudden urge to play Lemmings now. :D
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 9:10,
archived )
cute ^^
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 10:33,
archived )
Awww :D
But why are they holding sticks? Are they going to have a duel?www.youtube.com/watch?v=AphxyjrH4SE
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 8:08,
archived )
Hello Fox :D
They have a hose for the disinfection. I saw this scene in photo. (At school)
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 10:33,
archived )
Ahh, I see. ^^
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 10:38,
archived )
if she is already dead why does she need a gas mask.
(
Foxglove -- it all ends in tears anyway... ,
Tue 22 May 2012, 4:25,
archived )
XD
(
Q4nobody ,
Mon 21 May 2012, 9:16,
archived )
I'm not much of a lip reader but I don't think he's saying Dave
(
Dick Wonder ₐ wₒₙₖy, wₐᵥy wₒₙdₑᵣ ,
Mon 21 May 2012, 10:40,
archived )
He's saying it in Japanese
;)
(
Q4nobody ,
Mon 21 May 2012, 13:39,
archived )
yay for gasmasks
(
discomeats This canoe ,
Mon 21 May 2012, 12:20,
archived )
\o/
(
Bourbon Fox Bourbon is a moron ,
Mon 21 May 2012, 12:30,
archived )
:D
cool ^^
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 13:38,
archived )
Hehe :D
(
Death is the Eternal I have not my ally ,
Mon 21 May 2012, 13:37,
archived )
Won't someone think of the animals...
(
Pandemonium in my underpants ,
Mon 21 May 2012, 0:17,
archived )
This guy was shouting at ducks, last week.
What a bastard.
(
Captain Howdy ,
Mon 21 May 2012, 0:25,
archived )
I thought this too, but on closer inspection it's a different guy
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 0:35,
archived )
Another case solved, Holmes!
(
Captain Howdy ,
Mon 21 May 2012, 0:39,
archived )
he is still a bastard, though
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 0:42,
archived )
Yeah, there is that.
(
Captain Howdy ,
Mon 21 May 2012, 0:43,
archived )
That German Shepherd
is like "pffft, whatever".
(
Cock ,
Mon 21 May 2012, 3:56,
archived )
he's not the only one
(
h3donist tryin' to play me out as if my name is Sega.. ,
Mon 21 May 2012, 1:05,
archived )
btw, I like this :)
(
Ham o' Shatner -.-- --- ..- .-. / .- .-.. .-.. / --. .- -.-- ,
Mon 21 May 2012, 0:56,
archived )
It can happen the other way round too.
(
Tahkcalb ω∞ for sigs ,
Mon 21 May 2012, 2:14,
archived )
:D
(
HappyToast Groat froth ,
Mon 21 May 2012, 5:58,
archived )
Haw!
The cat is not taking it well.
(
Willmot laid a scotch egg ,
Mon 21 May 2012, 7:27,
archived )
haha
:D
(
hekim 66 ɐʇƐ𐐒 ʞɔnℲ uooW ,
Mon 21 May 2012, 9:50,
archived )
Hide
Hide post If you want to unhide this post later, click the "update profile" link in the top navigation bar, and scroll down to the bottom.
Ignore
Shush them a week You will be blisfully unaware of this user for just one week
Mute user You will not see this users messages again
Block user You will not see them and they will not see you
« Older messages | Newer messages »